

Sequences, primers and metadata information stored in spreadsheets can be uploaded to Geneious from either. CSV/TSV (Comma/Tab Separated Values) and Excel spreadsheet files csfasta files represent the color calls generated by the SOLiD sequencing system. HQ625581 MRVMGIPRNWPQWWIWGILGFWIMLMCRVEENSWVTVYYGVPVWKEATTTLFCASDAKAYĪBI. HQ625568 MRVRGTQRNWPQWWIWTSLGFWIILMCR-GNLWVTVYYGVPVWTDAKTTLFCASDAKAY HQ625588 MRVMGKWRNCQQWWIWGILGFWIILICN-AEQLWVTVYYGVPVWKEAKTTLFCASDAKAY HQ625572 MRVKGILKNYQQWWIWVILGFWMLMICNVVGNQWVTVYYGVPVWREAKATLFCASDAKAY

HQ625589 MRVKGRSRNYPQWWVWGILGFWMFMICNGVGNRWVTVYYGVPVWKEAKATLFCASDAKAY HQ625570 MRVMGMWRNYPQWWIWGILGLWM-ICSVVGKLWVTVYYGVPVWTDAKATLFCASDAKAY An example Clustal file: CLUSTAL W (1.74) multiple sequence alignment Ĭlustal format files are used to store multiple sequence alignments and contain the word clustal at the beginning. The Clustal format is used by the well known multiple sequence alignment programs ClustalW, ClustalX and Clustal Omega. pd4 are not currently supported for import. Currently it does not import other fields, restriction cut sites or primer binding sites. This will import name, description, topology, sequence and annotations. Geneious can import annotated sequences files in the standard Clone Manager molecule format. You can use a BED file to annotate existing sequences in your local database, import entirely new sequences, or import the annotations onto blank sequences. The BED format contains sequence annotation information. PHYLIP, PAUP*, Figtree, other tree building programs Geneious Prime version can import the following file formats: Format If no reference sequence is present in the imported documents, you will be prompted to select a reference from existing documents in your database, or load onto a blank sequence. Sequence IDs in the files must match for the import to proceed correctly. The reference sequence will be loaded first, followed by the annotation and assembly files. Any combination of these files can be selected and then dragged and dropped into Geneious.

In version 11.1 onwards, Geneious supports bulk import of a mixture of SAM, BAM, GFF, BED, VCF and Fasta formatted files, allowing sequence, annotation and assembly information to be imported in a single step.
#SNAPGENE VIEWER ASTERISK ZIP#
In version 10.1 and above zip files containing multiple files and subfolders can also be imported. If the folder has subfolders, the folder structure will be retained when it is imported into Geneious. To import an entire folder and all its subfolders and files into Geneious Prime in one step, click the Add button and choose Import Folder, or go to File → Import → Folder. If no folder is selected, you will be prompted to choose a folder during the import. The different file formats that Geneious can import are described in detail in the next section.įiles can also be dragged and dropped from your hard drive directly into Geneious and the file type will automatically be determined.įiles imported from disk are imported directly into the currently selected local folder within Geneious. This will open up a window where you can either select the file format or let Geneious autodetect the format. To import files from local disks or network drives, click the Add button in the Toolbar and select Import Files, or go to File → Import → Files. Importing data from the hard drive to your Local folders All import and export options can be accessed via the Add and Export buttons in the Toolbar, or via the File menu. Geneious Prime is able to import raw data from different applications and export the results in a range of formats.
